RP02791LQ
Recombinant Human Lactate Dehydrogenase A/LDHA Protein
Größe
£145.00
- SKU:
- RP02791LQ
- Zusätzliche Namen:
- GSD11|HEL-S-133P|LDHA|LDHM|PIG19
- Molekulargewicht:
- 40-45 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Phe332
- Formulierung:
- Recombinant Human Lactate Dehydrogenase A/LDHA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe332) of human Lactate Dehydrogenase A/LDHA (Accession #NP_005557.1) fused with a 6xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
- Uniprot:
- P00338
- Synonyme:
- cell proliferation-inducing gene 19 protein;epididymis secretory sperm binding protein Li 133P;GSD11;HEL-S-133P;L-lactate dehydrogenase A chain;lactate dehydrogenase M;LDH muscle subunit;LDH-A;LDH-M;LDHM;PIG19;proliferation-inducing gene 19;renal carcinoma antigen NY-REN-59
- Weitere Details:
- L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.
- Versandbedingungen:
- Dry Ice