RP02738
Recombinant Human IGFBP-7 Protein
Größe
£145.00
- SKU:
- RP02738
- Zusätzliche Namen:
- AGM|FSTL2|IBP7|IGFBP-7|IGFBP-7v|IGFBP7|IGFBPRP1|MAC25|PSF|RAMSVPS|TAF
- Molekulargewicht:
- 35-40 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asp30-Leu282
- Formulierung:
- Recombinant Human IGFBP-7 Protein Protein is expressed from Expi293 with His tag at the N-terminal.; It contains Asp30-Leu282
- Spezies:
- Human
- Sequenz:
- DTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
- Uniprot:
- Q16270
- Synonyme:
- AGM;angiomodulin;FSTL2;IBP-7;IGF-binding protein 7;IGFBP-7;IGFBP-7v;IGFBP-rP1;IGFBPRP1;insulin-like growth factor-binding protein 7;MAC25;MAC25 protein;PGI2-stimulating factor;prostacyclin-stimulating factor;PSF;RAMSVPS;TAF;tumor-derived adhesion factor
- Weitere Details:
- IGFBP-7, also known as Mac25/Angiomodulin (AGM), GFBP-rp1, tumor-derived adhesion factor (TAF) and prostacyclin-stimulating factor (PSF), is a secreted protein that contains three protein domain modules. Human IGFBP-rp1 cDNA encodes 282 amino acid (aa) residue precursor protein with a putative 26 aa signal peptide. IGFBP-7 binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
- Versandbedingungen:
- Blue Ice