RP02615
Recombinant Mouses LAMP5 Protein
Größe
£353.00
- SKU:
- RP02615
- Zusätzliche Namen:
- BAD-LAMP|BADLAMP|C20orf103|dJ1119D9.3|LAMP-5|UNC-43
- Molekulargewicht:
- 60-70 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu30-Glu235
- Formulierung:
- Recombinant Mouses LAMP5 Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Glu30-Glu235.
- Spezies:
- Mouse
- Sequenz:
- EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEE
- Uniprot:
- Q9D387
- Synonyme:
- 3110035N03Rik;6330527O06Rik;BAD-;BAD-LAMP;brain and dendritic cell-associated LAMP;brain-associated LAMP-like protein;LAMP family protein C20orf103 homolog;LAMP-5;lysosome-associated membrane glycoprotein 5;lysosome-associated membrane protein 5;Protein C20orf103
- Weitere Details:
- Lysosome-associated membrane protein 5 (LAMP5) is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles. LAMP5 deficiency led to a larger intensity-dependent increase of wave I, II and V peak amplitude of auditory brainstem response. LAMP5 plays a pivotal role in sensorimotor processing in the brainstem and spinal cord.
- Versandbedingungen:
- Blue Ice