RP02614
Recombinant Mouse BAMBI Protein
Größe
£336.00
- SKU:
- RP02614
- Zusätzliche Namen:
- Bambi|Nma
- Molekulargewicht:
- 49-55 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu27-Ala152
- Formulierung:
- Recombinant Mouse BAMBI Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Glu27-Ala152.
- Spezies:
- Mouse
- Sequenz:
- EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA
- Uniprot:
- Q9D0L6
- Synonyme:
- 2610003H06Rik;BMP and activin membrane-bound inhibitor homolog;BMP and activin membrane-bound inhibitor, homolog;putative transmembrane protein NMA
- Weitere Details:
- Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane protein that affects the growth, development and muscle regeneration of the body by regulating the TGF-B Beta, BMP and Wnt signaling pathways. In brief, BAMBI may be a functional gene for the differentiation of bovine preadipocytes and myoblasts, and variations in the BAMBI genomic region, especially the combined haplotype H1H4, may benefit marker-assisted selection in cattle.
- Versandbedingungen:
- Blue Ice