RP02529
Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein
Größe
£508.00
- SKU:
- RP02529
- Zusätzliche Namen:
- Fibroblast growth factor receptor 2; FGFR-2; KGFR; K-sam; Keratinocyte growth factor receptor; CD332; BEK; KSAM
- Molekulargewicht:
- 60-68 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Pro253-Glu378
- Formulierung:
- Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro253-Glu378) of human FGFR-2 beta (IIIb)/KGFR/CD332 (Accession #P21802-3) fused with hFc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- PHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLE
- Uniprot:
- P21802-3
- Synonyme:
- bacteria-expressed kinase;BBDS;BEK;BEK fibroblast growth factor receptor;BFR-1;CD332;CEK3;CFD1;ECT1;fibroblast growth factor receptor 2;JWS;K-SAM;keratinocyte growth factor receptor;KGFR;protein tyrosine kinase, receptor like 14;TK14;TK25
- Weitere Details:
- Four distinct genes encoding closely related FGF receptors, FGF R1 - 4, are known. All four genes for FGF Rs encode proteins with an N-terminal signal peptide, three immunoglobulin (Ig)-like domains, an acid-box region containing a run of acidic residues between the IgI and IgII domains, a transmembrane domain and the split tyrosine-kinase domain. Multiple forms of FGF R1 - 3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGF R1 and 2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the beta isoform.
- Versandbedingungen:
- Blue Ice