Recombinant Human/Mouse/Rat Mature BMP-4 Protein

Größe

£223.00

SKU:: RP02512S1
Zusätzliche Namen:: BMP4, BMP2B, DVR4,Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B
Molekulargewicht:: 15-25 kDa
Spezies-Reaktivität:: Human, Mouse, Rat
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser293-Arg408
Formulierung:: Recombinant Human/Mouse/Rat Mature BMP-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-Arg408) of Human Mature BMP-4 (Accession #NP_001193.2) fused with no tag.
Spezies:: Human, Mouse, Rat
Sequenz:: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Uniprot:: P12644
Synonyme:: BMP2B;BMP2B1;bone morphogenetic protein 2B;bone morphogenetic protein 4;MCOPS6;OFC11;ZYME
Weitere Details:: Recombinant Human/Mouse/Rat Mature BMP-4 Protein that in humans is encoded by BMP4 gene. BMP4 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. BMP4 is highly conserved evolutionarily. BMP4 is found in early embryonic development in the ventral marginal zone and in the eye, heart blood and otic vesicle.