RP02360
Recombinant Human Flt3 ligand/Flt3L Protein
Größe
£145.00
- SKU:
- RP02360
- Zusätzliche Namen:
- FL,FLT3L,FLT3LG,FLT3LG
- Molekulargewicht:
- 50-65 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Thr27-Pro185
- Formulierung:
- Recombinant Human FLT3 ligand Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Thr27-Pro185) of Human FLT3 ligand fused with a hFc at the C-terminal.
- Spezies:
- Human
- Sequenz:
- TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
- Uniprot:
- P49771
- Synonyme:
- FL;FLG3L;flt3 ligand;FLT3L;fms related tyrosine kinase 3 ligand;fms-related tyrosine kinase 3 ligand;SL cytokine
- Versandbedingungen:
- Blue Ice