RP02353
Recombinant Human TNFSF6/FAS ligand/CD178 Protein
Größe
£223.00
- SKU:
- RP02353
- Zusätzliche Namen:
- FASLG,ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A,Fas ligand,FasL,FasLG
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Pro134-Leu281
- Formulierung:
- Recombinant Human TNFSF6/FAS ligand/CD178 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Pro134-Leu281) of Human Fas Ligand(monomer) fused with a His tag at the N-terminal.
- Spezies:
- Human
- Sequenz:
- PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
- Uniprot:
- P48023
- Synonyme:
- ALPS1B;apoptosis (APO-1) antigen ligand 1;apoptosis antigen ligand;APT1LG1;APTL;CD178;CD95 ligand;CD95-L;CD95L;fas antigen ligand;Fas ligand (TNF superfamily, member 6);FASL;mutant tumor necrosis factor family member 6;TNFSF6;TNLG1A;tumor necrosis factor ligand 1A;tumor necrosis factor ligand superfamily member 6
- Versandbedingungen:
- Blue Ice