Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein

Größe

£113.05

War £133.00

SKU:: RP02179
Zusätzliche Namen:: ANGPTL4,ARP4,FIAF,HARP,HFARP,NL2,PGAR,TGQTL,UNQ171,pp1158
Molekulargewicht:: 32-38 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Pro166-Ser406
Formulierung:: Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Pro166-Ser406) of human ANGPTL4 (Accession #Q9BY76) fused with a 6xHis tag at the N-terminus.
Spezies:: Human
Sequenz:: PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Uniprot:: Q9BY76
Synonyme:: Angiopoietin-like protein 4;angiopoietin-related protein 4;ARP4;fasting-induced adipose factor;FIAF;HARP;hepatic angiopoietin-related protein;hepatic fibrinogen/angiopoietin-related protein;HFARP;NL2;peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein;PGAR;pp1158;PPARG angiopoietin related protein;TGQTL;UNQ171
Weitere Details:: Angiopoietin-related protein 4 ( ANGPTL4 ) is a secreted protein and contains 1 fibrinogen C-terminal domain. The protein may act as a regulator of angiogenesis and modulate tumorigenesis. It inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. ANGPTL4 may exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity (By similarity). In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.

Versandbedingungen:: Blue Ice