Recombinant Human LILRB5/LIR-8/CD85c Protein

Größe

£145.00

SKU:: RP02158
Zusätzliche Namen:: CD85C, LIR-8, LIR8, LILRB5
Molekulargewicht:: 65-75 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly24-His456
Formulierung:: Recombinant Human LILRB5/LIR-8/CD85c Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gly24-His456) of human LILRB5 (Accession #O75023) fused with a 6xHis tag at the C- terminus.
Spezies:: Human
Sequenz:: GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH
Uniprot:: O75023
Synonyme:: CD85 antigen-like family member C;CD85C;leucocyte Ig-like receptor B5;leukocyte immunoglobulin-like receptor 8;leukocyte immunoglobulin-like receptor subfamily B member 5;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5;LIR-8;LIR8
Weitere Details:: Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 (LILRB5/CD85c/LIR-8) belongs to a family of transmembrane glycoproteins that negatively regulate immune cell activation. Mature human LIR-8 consists of a 435 amino acid (aa) extracellular domain with four Iglike domains, a 21 aa transmembrane segment, and a 111 aa cytoplasmic domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIM). Alternative splicing of human LIR-8 generates an isoform that lacks the second Ig- like domain. LIR-8 is expressed on NK cells and in the tryptic granules of mast cells. Following cell activation and degranulation, it is present on the mast cell surface. Activated mast cells may also release soluble forms of LIR-8.

Versandbedingungen:: Blue Ice