RP02141
Recombinant Human TMPO Protein
Größe
£145.00
- SKU:
- RP02141
- Zusätzliche Namen:
- TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin,CMD1T,LAP2,LEMD4,PRO0868,TP
- Molekulargewicht:
- 27 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Pro2-Glu187
- Formulierung:
- Recombinant Human TMPO Protein is produced by E.coli expression system. The target protein is expressed with sequence (Pro2-Glu187) of human TMPO (Accession #P42167) fused with a 6xHis tag at the C- terminus.
- Spezies:
- Human
- Sequenz:
- PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
- Uniprot:
- P42166
- Synonyme:
- CMD1T;lamina-associated polypeptide 2;LAP2;LEM domain containing 4;LEMD4;PRO0868;thymopoietin;Thymopoietin isoform alpha;Thymopoietin-related peptide isoform alpha;TP
- Weitere Details:
- Thymopentin is a member of the LEM family. Thymopentin is expressed in many tissues, highly in the adult thymus and fetal liver. The N-terminal contains two structurally independent domains, LEM domain and LEM-like domain. The C-terminal domain forms a four-stranded coiled coil. Thymopentin may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It is associated with T-cell development and function. Meantime, Thymopentin plays an important role, together with LMNA, in the nuclear anchorage of RB1. Thymopoietin is participated in the induction of CD90 in the thymus.
- Versandbedingungen:
- Blue Ice