RP02140
Recombinant Human PRL-2 Protein

Größe
£145.00
- SKU:
- RP02140
- Zusätzliche Namen:
- PTP4A2,HH13,HH7-2,HU-PP-1,OV-1,PRL-2,PRL2,PTP4A,PTPCAAX2,ptp-IV1a,ptp-IV1b
- Molekulargewicht:
- 18 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Gln167
- Formulierung:
- Recombinant Human PRL-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Gln167) of human PRL2 (Accession #Q12974) fused with a 6xHis tag at the C- terminus.
- Spezies:
- Human
- Sequenz:
- MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
- Uniprot:
- Q12974
- Synonyme:
- HH13;HH7-2;HU-PP-1;OV-1;phosphatase of regenerating liver 2;PRL-2;PRL2;protein tyrosine phosphatase IVA;protein tyrosine phosphatase IVA2;protein tyrosine phosphatase type IVA 2;protein tyrosine phosphatase type IVA, member 2;Protein-tyrosine phosphatase 4a2;protein-tyrosine phosphatase of regenerating liver 2;ptp-IV1a;ptp-IV1b;PTP(CAAXII);PTP4A;PTPCAAX2
- Weitere Details:
- PTP4A2, also known as PRL2 or PTPCAAX2, is short for Protein tyrosine phosphatase type IVA 2. This protein exists in cell membrane, cytoplasm,endosome and membrane. PTP4A2 is often farnesylated during post-translational modification. Farnesylation is required for membrane targeting and for interaction with RABGGTB. The unfarnesylated forms are redirected to the nucleus and cytosol. It can stimulate progression from G1 into S phase during mitosis and promotes tumors. It also inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.
- Versandbedingungen:
- Blue Ice

