RP02104
Recombinant SARS-CoV-2 Spike RBD(B.1.640.2/IHU) Protein
Größe
£395.00
- SKU:
- RP02104
- Zusätzliche Namen:
- Envelope,SARS-CoV-2 Spike RBD (N501Y),Spike,Spike ECD,Spike RBD,Spike S1,Spike S2,Spike S2 ECD,S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg319-Phe541(R346S, N394S, Y449N, E484K, F490S, N501Y)
- Formulierung:
- Recombinant SARS-CoV-2(2019-nCoV) Spike RBD(B.1.640.2/IHU)-His Protein is produced by Expi293 cells expression system. The target protein is expressed with sequence (Arg319-Phe541(R346S, N394S, Y449N, E484K, F490S, N501Y)) of SARS-COV-2(2019-nCoV) Spike RBD(B.1.640.2/IHU)-His (Accession #QHD43416.1) fused with His tag at the C-terminus.
- Spezies:
- Virus
- Sequenz:
- RVQPTESIVRFPNITNLCPFGEVFNATSFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTSVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNNNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYSPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
- Synonyme:
- GU280_gp02;spike glycoprotein;surface glycoprotein
- Weitere Details:
- The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
- Versandbedingungen:
- Blue Ice