RP02082
Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein
Größe
£127.00
- SKU:
- RP02082
- Zusätzliche Namen:
- TNFRSF10A,APO2,CD261,DR4,TRAILR-1,TRAILR1
- Molekulargewicht:
- 20-25 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala109-Asn239
- Formulierung:
- Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Ala109-Asn239) of Human TRAIL R1 / DR4 / TNFRSF10A fused with His tag at the C-terminal.
- Spezies:
- Human
- Sequenz:
- ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN
- Uniprot:
- O00220
- Synonyme:
- APO2;CD261;cytotoxic TRAIL receptor;death receptor 4;DR4;TNF-related apoptosis-inducing ligand receptor 1;TRAIL receptor 1;TRAIL-R1;TRAILR-1;TRAILR1;tumor necrosis factor receptor superfamily member 10A;tumor necrosis factor receptor superfamily member 10a variant 2;tumor necrosis factor receptor superfamily, member 10a
- Weitere Details:
- Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A) is also known as TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1), Death receptor 4 (DR4), CD261 and APO2, which belongs to TNF superfamily.The expression of apoptosis-inducing TRAIL-R1 and TRAIL-R2 and of the decoy receptors TRAIL-R3 and TRAIL-R4 was systematically studied in all developmental stages of peripheral B cells isolated from the blood and secondary lymphoid organs. Expression of TRAIL-Rs is modulated along development, with highest levels observed in germinal center B cells.
- Versandbedingungen:
- Blue Ice