RP02041
Recombinant Human DLL3 Protein
Größe
£395.00
- SKU:
- RP02041
- Zusätzliche Namen:
- Delta-like protein 3|DLL3|SCDO1
- Molekulargewicht:
- 55-60 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala27-Arg490
- Formulierung:
- Recombinant Human CD40L/CD154 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala27-Arg491) of human DLL3 (Accession #Q9NYJ7) fused with His at the N-terminus.
- Spezies:
- Human
- Sequenz:
- AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR
- Uniprot:
- Q9NYJ7
- Synonyme:
- delta-like 3;delta-like protein 3;delta3;drosophila Delta homolog 3;SCDO1
- Weitere Details:
- Delta-like 3 (Drosophila), also known as DLL3, is a protein which in humans is encoded by the DLL3 gene.Two transcript variants encoding distinct isoforms have been identified for this gene.Mutations in this gene cause the autosomal recessive genetic disorder Jarcho-Levin syndrome.Expression of the gene occurs in Neuroendocrine tumors, which has been targeted as a potential pathway for treatment.
- Versandbedingungen:
- Blue Ice