Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Größe

£133.00

SKU:: RP02008
Zusätzliche Namen:: AGPT2, ANG2,ANGPT2,ANG2
Molekulargewicht:: 35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Lys275-Phe496
Formulierung:: Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by mammalian expression system. The target protein is expressed with sequence (Lys275-Phe496) of human Angiopoietin-2/ANGPT2 (Accession #O15123) fused with 6xHis at the C-terminus.
Spezies:: Human
Sequenz:: KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Uniprot:: O15123-1
Synonyme:: AGPT2;ANG2;angiopoietin-2;angiopoietin-2a;angiopoietin-2B;LMPHM10;Tie2-ligand
Weitere Details:: Angiopoietin-2 (Ang-2; also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation . Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.