RP01986
Recombinant Human LRG1(P133S) Protein
Größe
£145.00
- SKU:
- RP01986
- Zusätzliche Namen:
- LRG1, LRG,Leucine-rich alpha-2-glycoprotein, LRG
- Molekulargewicht:
- 45-55 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Vla36-Gln347 (Pro133Ser)
- Formulierung:
- Recombinant Human LRG1(P133S) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Vla36-Gln347 (Pro133Ser) ) of Human LRG1(P133S) (Accession #NP_443204.1) fused with His tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
- Uniprot:
- P02750
- Synonyme:
- 1300008B03Rik;2310031E04Rik;HMFT1766;leucine rich alpha 2 glycoprotein;leucine-rich alpha-2-glycoprotein;LRG
- Weitere Details:
- Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.
- Versandbedingungen:
- Blue Ice