Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein

Größe

£145.00

SKU:: RP01985
Zusätzliche Namen:: CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
Molekulargewicht:: 10-15 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly28-Asn93
Formulierung:: Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Asn93) of Human CCL14/HCC-1/HCC-3(28-93) (Accession #NP_116739.1) fused with His at the C-terminus.
Spezies:: Human
Sequenz:: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Uniprot:: Q16627
Synonyme:: C-C motif chemokine 14;CC-1;CC-3;chemokine (C-C motif) ligand 14;chemokine CC-1/CC-3;chemokine CC-3;CKB1;HCC-1;HCC-1(1-74);HCC-1/HCC-3;HCC-3;hemofiltrate CC chemokine 1;MCIF;NCC-2;NCC2;new CC chemokine 2;SCYA14;SCYL2;small inducible cytokine subfamily A (Cys-Cys), member 14;small-inducible cytokine A14;SY14
Weitere Details:: Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.

Versandbedingungen:: Blue Ice