RP01980
Recombinant Mouse C7orf50(Cholesin) Protein
Größe
£145.00
- SKU:
- RP01980
- Zusätzliche Namen:
- C7orf50, 3110082I17Rik,Cholesin, Protein C7orf50
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Ser195
- Formulierung:
- Recombinant Mouse C7orf50(Cholesin) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser195) of Mouse 3110082I17Rik(Cholesin) (Accession #NP_082745.2) fused with His at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- MAKHKRKGLEGTGKESKRQKITPAEETPRTSEAGPDKETASTLVQEASPELSPEERRVLERKLKKERKKEEKKRLREAGIAATQTAKVQTLPAKPSAATLALEYLQGWAQKQESWRFQKTRQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKAEALMQKLDEAEPEDSGGSPGKVQRLRQVLQLLS
- Uniprot:
- Q9CXL3
- Synonyme:
- AW411904;uncharacterized protein C7orf50 homolog
- Weitere Details:
- Hormone secreted from the intestine in response to cholesterol, where it acts to inhibit cholesterol synthesis in the liver and VLDL secretion,leading to a reduction in circulating cholesterol levels. Acts through binding to its receptor, GPR146.
- Versandbedingungen:
- Blue Ice