RP01977
Recombinant Human TNF-beta Protein

Größe
£133.00
- SKU:
- RP01977
- Zusätzliche Namen:
- LTA, TNFB, TNFSF1,Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1
- Molekulargewicht:
- 20-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu35-Leu205
- Formulierung:
- Recombinant Human TNF-beta Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Leu35-Leu205) of Human TNF-beta(Accession #NP_000586.2) fused with His at the C-terminus.
- Spezies:
- Human
- Sequenz:
- LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
- Uniprot:
- P01374
- Synonyme:
- LT;LT-alpha;lymphotoxin-alpha;TNF superfamily, member 1;TNF-beta;TNFB;TNFSF1;TNLG1E;truncated lymphotoxin alpha;tumor necrosis factor beta;tumor necrosis factor ligand 1E;tumor necrosis factor ligand superfamily member 1
- Weitere Details:
- Tumor Necrosis Factor B Beta (TNF- B Beta ) is a secreted protein belonging to the tumor necrosis factor family. TNF- B Betabinds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds toTNFRSF3/LTBR in heterotrimeric form with LTB. TNF- B Beta forms heterotrimers with lymphotoxin-beta, whichanchors TNF- B Beta to the cell surface. TNF- B Beta mediates the inflammatory, immunostimulatory, and antiviralresponse, involves in the formation of second lymphoid organs during development, has a role in apoptosis.TNF-B Beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
- Versandbedingungen:
- Blue Ice

