RP01966
Recombinant Human CCL15/MIP-5/HCC-2 Protein
Größe
£145.00
- SKU:
- RP01966
- Zusätzliche Namen:
- CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser46-Ile113
- Formulierung:
- Recombinant Human CCL15/MIP-5/HCC-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser46-Ile113) of Human CCL15/MIP-5/HCC-2 (Accession #NP_116741.2) fused with His at the C-terminus.
- Spezies:
- Human
- Sequenz:
- SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
- Uniprot:
- Q16663
- Synonyme:
- C-C motif chemokine 15;chemokine (C-C motif) ligand 15;chemokine CC-2;HCC-2;HMRP-2B;leukotactin 1;Leukotactin-1;LKN-1;LKN1;macrophage inflammatory protein 5;MIP-1 delta;MIP-1D;MIP-5;MRP-2B;NCC-3;NCC3;new CC chemokine 3;SCYA15;SCYL3;small inducible cytokine subfamily A (Cys-Cys), member 15;small-inducible cytokine A15;SY15
- Weitere Details:
- Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.
- Versandbedingungen:
- Blue Ice