Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein

Größe

£145.00

SKU:: RP01963
Zusätzliche Namen:: ITPRIPL1, KIAA1754L,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
Molekulargewicht:: 10-15KDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: His25-103Gly
Formulierung:: Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His25-103Gly) of Human ITPRIPL1/KIAA1754L/CD3L1 (Accession #NP_001008949.1) fused with a His tag at the C-terminus.
Spezies:: Human
Sequenz:: HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Uniprot:: Q6GPH6
Synonyme:: inositol 1,4,5-triphosphate receptor-interacting protein-like 1;inositol 1,4,5-trisphosphate receptor interacting protein-like 1;inositol 1,4,5-trisphosphate receptor-interacting protein-like 1;KIAA1754L
Weitere Details:: ITPRIPL1/KIAA1754L/CD3L1 is a transmembrane protein with broad expression in the testis associated with immune evasion. In fact, ITPRIPL1 is a molecule specifically expressed in immune privileged tissues, "hot" tumors without PD-L1 expression, and non-responding tumors to PD-1 blockade therapy. ITPRIPL1 has been shown to impair T cell function in vitro and in vivo through CD3e with experimental evidence supporting a negative correlation between ITPRIPL1 expression level in antigen-presenting cells and T cell cytotoxicity. ITPRIPL1 was a hypermethylated-low expression gene in breast cancer and acted as an independent biomarker for the prognosis of lung adenocarcinoma by using bioinformatics methods. Thus, targeting the ITPRIPL1-CD3e axis, especially in PD-1 - PD-L1 negative patients, is a promising therapeutic strategy to reduce immune evasion.

Versandbedingungen:: Blue Ice