RP01962
Recombinant Human AMHR2/MISR2 Protein
Größe
£133.00
- SKU:
- RP01962
- Zusätzliche Namen:
- AMHR2, AMHR, MISR2,Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII
- Molekulargewicht:
- 45-60 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Pro18-Ser144
- Formulierung:
- Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro18-Ser144) of Human AMHR2/MISR2(Accession #Q16671) fused with a hFC tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- PNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
- Uniprot:
- Q16671
- Synonyme:
- AMH type II receptor;AMHR;anti-Muellerian hormone type II receptor;anti-Muellerian hormone type-2 receptor;anti-Mullerian hormone receptor, type II;MIS type II receptor;MISR2;MISRII;MRII;Muellerian inhibiting substance type II receptor;Mullerian inhibiting substance type II receptor
- Weitere Details:
- AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.
- Versandbedingungen:
- Blue Ice