Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein

Größe

£138.55

War £163.00

SKU:: RP01933
Zusätzliche Namen:: CXCR1, CMKAR1, IL8RA,C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181
Molekulargewicht:: 45-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Lys39
Formulierung:: Recombinant Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys39) of Human CXC-chemokine receptor 1/CXCR1 (Accession #NP_000625.1) fused with hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Uniprot:: P25024
Synonyme:: C-C;C-C-CKR-1;C-X-C chemokine receptor type 1;CD128;CD181;CDw128a;chemokine (C-X-C motif) receptor 1;CKR-1;CMKAR1;CXC-R1;CXCR-1;high affinity interleukin-8 receptor A;IL-8 receptor type 1;IL-8R A;IL8R1;IL8RA;IL8RBA;interleukin 8 receptor, alpha;interleukin-8 receptor type 1;interleukin-8 receptor type A
Weitere Details:: Human CXC-chemokine receptor 1/CXCR1, Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor .Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.