Recombinant Human Mucin-2 /MUC2 Protein

Größe

£508.00

SKU:: RP01931LQ
Zusätzliche Namen:: MUC2, SMUC,Mucin-2, MUC-2, Intestinal mucin-2
Molekulargewicht:: 60-75 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly858-Thr1259
Formulierung:: Recombinant Human Mucin-2 /MUC2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly858-Thr1259) of Human Mucin-2 /MUC2 (Accession #NP_002448.4) fused with a His tag at the C-terminus.
Spezies:: Human
Sequenz:: TCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSIT
Uniprot:: Q02817
Synonyme:: Intestinal mucin-2;MLP;MUC-2;mucin 2, intestinal/tracheal;mucin-2;SMUC
Weitere Details:: MUC2 Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.