RP01929
Recombinant Rat IL-18 Protein
Größe
£145.00
- SKU:
- RP01929
- Zusätzliche Namen:
- Il18, Igif,Interleukin-18, IL-18, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma
- Molekulargewicht:
- 20-25 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- His37-Ser194
- Formulierung:
- Recombinant Recombinant Rat IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His37-Ser194) of Rat IL-18 (Accession #NP_062038.1) fused with a His tag at the C-terminus.
- Spezies:
- Rat
- Sequenz:
- FGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
- Uniprot:
- P97636-1
- Synonyme:
- IFN-gamma-inducing factor;IL-1 gamma;IL-18;interferon gamma-inducing factor;interleukin-1 gamma;interleukin-18
- Weitere Details:
- IL-18 ,Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
- Versandbedingungen:
- Blue Ice