RP01928
Recombinant Human MMP-7 Protein

Größe
£163.00
- SKU:
- RP01928
- Zusätzliche Namen:
- MMP7, MPSL1, PUMP1,Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase
- Molekulargewicht:
- 30-40 kDa
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Lys267
- Formulierung:
- Recombinant Recombinant Human MMP-7 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Met1-Lys267) of Human MMP-7 (Accession #NP_002414.1) fused with a His tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
- Uniprot:
- P09237
- Synonyme:
- matrilysin;matrin;matrix metallopeptidase 7 (matrilysin, uterine);matrix metalloproteinase 7 (matrilysin, uterine);matrix metalloproteinase-7;MMP-7;MPSL1;PUMP-1;pump-1 protease;uterine matrilysin;uterine metalloproteinase
- Weitere Details:
- MMP-7,Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.Matrix metalloproteinases (MMPs) are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-7 (matrilysin) is expressed in epithelial cells of normal and diseased tissues, and is capable of digesting a large series of proteins of the extracellular matrix including collagen IV and X, gelatin, casein, laminin, aggrecan, entactin, elastin and versican. MMP-7 is implicated in the activation of other proteinases such as plasminogen, MMP-1, MMP-2, and MMP-9. In addition to its roles in connective tissue remodeling and cancer, MMP-7 also regulates intestinal alpha -defensin activation in innate host defense, releases tumor necrosis factor-alpha in a model of herniated disc resorption, and cleaves FasL to generate a soluble form in a model of prostate involution. Structurally, MMP-7 is the smallest of the MMPs and consists of two domains: a pro-domain that is cleaved upon activation and a catalytic domain containing the zinc-binding site.
- Versandbedingungen:
- Blue Ice



