Recombinant Rat ALK-1/ACVRL1 Protein

Größe

£133.00

SKU:: RP01925
Zusätzliche Namen:: Acvrl1, Acvrlk1,Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, TGF-B superfamily receptor type I, TSR-I
Molekulargewicht:: 45-60 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Lys21-Ala118
Formulierung:: Recombinant Recombinant Rat ALK-1/ACVRL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys21-Ala118) of Rat ALK-1/ACVRL1 (Accession #NP_071886.1) fused with a hFc tag at the C-terminus.
Spezies:: Rat
Sequenz:: KGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDA
Uniprot:: P80203
Synonyme:: activin A receptor type II-like 1;activin A receptor type IL;Activin receptor like kinase 1;Alk1;R-3;R3;serine/threonine-protein kinase receptor R3;SETHKIR;SKR3;TGF-B superfamily receptor type I;TSR-I
Weitere Details:: ALK-1/ACVRL1,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.