Recombinant Human IFN-alpha G/IFNA5 Protein

Größe

£133.00

SKU:: RP01915
Zusätzliche Namen:: Ifa5|IFN-alpha G|IFN-alpha-5|IFN-alphaG|IFNA5|IFNalpha G|INFA5|interferon alpha-5|Interferon alpha-61|Interferon alpha-G|interferon, alpha 5|LeIF G
Molekulargewicht:: 20-25 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu22-Glu189
Formulierung:: Recombinant Human interferon-alpha/IFNA5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu22-Glu189) of Human interferon-alpha/IFNA5 (Accession #NP_002160.1) fused with a His tag at the C-terminus.
Spezies:: Human
Sequenz:: LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Uniprot:: P01569
Synonyme:: IFN-alpha-5;IFN-alphaG;INA5;INFA5;interferon alpha-5;interferon alpha-61;interferon alpha-G;leIF G
Weitere Details:: Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.

Versandbedingungen:: Blue Ice