Recombinant Rat Follistatin/FST Protein

Größe

£193.00

SKU:: RP01893
Zusätzliche Namen:: Fst,Follistatin, FS, Activin-binding protein
Molekulargewicht:: 45-50 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Trp344
Formulierung:: Recombinant Rat Follistatin/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Trp344) of Rat Follistatin/FST (Accession #NP_036693.1) fused with a His tag at the C-terminus.
Spezies:: Rat
Sequenz:: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
Uniprot:: P21674
Synonyme:: activin-binding protein;FOL1;follistatin;follistatin-A;FS;Fst-288;RATFOL1
Weitere Details:: Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation; negative regulation of transcription by RNA polymerase II; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development; keratinocyte proliferation; and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).

Versandbedingungen:: Blue Ice