Recombinant Mouse RETN Protein

Größe

£133.00

SKU:: RP01873
Zusätzliche Namen:: Resistin, Adipose tissue-specific secretory factor, ADSF, Adipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3, Retn, Fizz3
Molekulargewicht:: 35-45 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser21-Ser114
Formulierung:: Recombinant Mouse RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Ser114 ) of Mouse RETN (Accession #NP_075360.1) fused with hFc tag at the N-terminus.
Spezies:: Mouse
Sequenz:: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Uniprot:: Q99P87
Synonyme:: AD;adipose tissue-specific secretory factor;adipose-specific cysteine-rich secreted protein A12-alpha;ADSF;cysteine-rich secreted protein FIZZ3;dominant inhibitory adipocyte-specific secretory factor;Fizz;Fizz3;found in inflammatory zone 3;r;resistin;Rstn;Xcp;Xcp4
Weitere Details:: Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.