RP01845
Recombinant Human Gastrin-releasing peptide/GRP Protein
Größe
£145.00
- SKU:
- RP01845
- Zusätzliche Namen:
- BN|Gastrin-releasing peptide|GRP|GRP-10|preproGRP|progastrin-releasing peptide|proGRP
- Molekulargewicht:
- 45-55 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg22-Gly148
- Formulierung:
- Recombinant Human Gastrin-releasing peptide/GRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg22-Gly148) of human Gastrin-releasing peptide/GRP (Accession #) fused with a hFc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- RAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
- Uniprot:
- P07492
- Synonyme:
- BN;bombesin;gastrin-releasing peptide;GRP-10;neuromedin C;pre-progastrin releasing peptide;prepro-GRP;preproGRP;proGRP;testicular tissue protein Li 103
- Weitere Details:
- Gastrin-releasing peptide (GRP) is a neuropeptide with growth-stimulatory and tumorigenic properties, and neuropeptides have previously been suggested to play a role in the complex cascade of chemical activity associated with periodontal inflammation.
- Versandbedingungen:
- Blue Ice