RP01834
Recombinant Human CCL3L1 Protein
Größe
£145.00
- SKU:
- RP01834
- Zusätzliche Namen:
- 464.2|D17S1718|G0S19-2|LD78|LD78-beta(1-70)|LD78BETA|MIP1AP|SCYA3L|SCYA3L1
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala24-Ala93
- Formulierung:
- Recombinant Human CCL3L1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala24-Ala93) of human CCL3L1 (Accession #NP_001001437.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
- Uniprot:
- P16619
- Synonyme:
- 464.2;C-C motif chemokine 3-like 1;chemokine (C-C motif) ligand 3-like 1;chemokine (C-C motif) ligand 3-like 3;chemokine (C-C motif) ligand 3-like, centromeric;D17S1718;G0/G1 switch regulatory protein 19-2;G0S19-2;LD78;LD78-beta(1-70);LD78BETA;MIP1AP;PAT 464.2;SCYA3L;SCYA3L1;small inducible cytokine A3-like 1;Small-inducible cytokine A3-like 1;tonsillar lymphocyte LD78 beta protein
- Weitere Details:
- The two human MIP-1 alpha genes arise by duplication/mutation. They code for MIP-1 alpha isoforms CCL3/LD78 alpha and CCL3L1/LD78 beta, which share 94% amino acid (aa) sequence homology. Whereas the human CCL3/LD78 alpha is a single-copy gene, the human CCL3L1/LD78 beta gene copy number varies within the population. Human CCL3L1/LD78 beta cDNA encodes a 93 aa residue precursor with a 23 aa residue signal peptide that is cleaved to generate a 70 aa mature protein. Human CCL3L1/LD78 beta binds and signals through chemokine receptors CCR1 and CCR5. When compared to CCL3/LD78 alpha, CCL3L1/LD78 beta has higher binding affinity to CCR5, which also functions as a coreceptor for HIV-1 entry. The copy number of CCL3L1 is one of several genetic determinants of HIV-1 susceptibility (4).
- Versandbedingungen:
- Blue Ice