Recombinant Human FGF-18 Protein

Größe

Auf Anfrage

SKU:: RP01827
Zusätzliche Namen:: FGF-18; FGF18|ZFGF5
Molekulargewicht:: 30-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu28-Ala207
Formulierung:: Recombinant Human FGF-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu28-Ala207) of human FGF-18 (Accession #NP_003853.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Uniprot:: O76093
Synonyme:: FGF-18;fibroblast growth factor 18;ZFGF5
Weitere Details:: Fibroblast growth factor 18 (FGF18) is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that FGF18 is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Experiment datas identified FGF18 as a selective ligand for FGFR3 in limb bud mesenchymal cells, which suppressed proliferation and promoted their differentiation and production of cartilage matrix. FGF18 appears to regulate cell proliferation and differentiation positively in osteogenesis and negatively in chondrogenesis.

Versandbedingungen:: Blue Ice