Recombinant Human Lipocalin-2/NGAL/LCN2 Protein

Größe

£133.00

SKU:: RP01823
Zusätzliche Namen:: 24p3|LCN2|Lipocalin-2|MSFI|NGAL|p25
Molekulargewicht:: 55-60 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln21-Gly198
Formulierung:: Recombinant Human Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Gly198) of human Lipocalin-2/NGAL/LCN2 (Accession #NP_005555.2) fused with a hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Uniprot:: P80188
Synonyme:: 24p3;25 kDa alpha-2-microglobulin-related subunit of MMP-9;Lipocalin-2;migration-stimulating factor inhibitor;MSFI;neutrophil gelatinase-associated lipocalin;NGAL;oncogene 24p3;p25;siderocalin LCN2
Weitere Details:: Lipocalin-2 (LCN2), also known as neutrophil gelatinase-associated lipocalin (NGAL), is a 25 kDa protein belonging to the lipocalin superfamily. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein is a neutrophil gelatinase-associated lipocalin and plays a role in innate immunity by limiting bacterial growth as a result of sequestering iron-containing siderophores. The presence of this protein in blood and urine is an early biomarker of acute kidney injury. This protein is thought to be be involved in multiple cellular processes, including maintenance of skin homeostasis, and suppression of invasiveness and metastasis. Mice lacking this gene are more susceptible to bacterial infection than wild type mice.

Versandbedingungen:: Blue Ice