RP01822
Recombinant Mouse MYDGF Protein

Größe
£163.00
- SKU:
- RP01822
- Zusätzliche Namen:
- Mydgf,Myeloid-derived growth factor, MYDGF
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Val25-Leu166
- Formulierung:
- Recombinant Mouse MYDGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val25-Leu166) of mouse MYDGF (Accession #NP_543027.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
- Uniprot:
- Q9CPT4
- Synonyme:
- D17Wsu104;D17Wsu104e;Il25;Interleukin-25;Ly6elg;myeloid-derived growth factor;Stromal cell-derived growth factor SF20;UPF0556 protein C19orf10 homolog
- Weitere Details:
- Myeloid-derived growth factor (MYDGF) is a secreted protein which belongs to the UPF0556 family. MYDGF was strongly expressed in spleen, prostate and lung, and weakly expressed in the left ventricle and liver. Bone marrow-derived monocyte and paracrine-acting protein promotes cardiac myocyte survival and adaptive angiogenesis for cardiac protection and/or repair after myocardial infarction (MI). MYDGF stimulates endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway. It inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway. MYDGF is involved in endothelial cell proliferation and angiogenesis. It may serve as a prototypical example for the development of protein-based therapies for ischemic tissue repair.
- Versandbedingungen:
- Blue Ice

