RP01821
Recombinant Human FSH Beta Protein

Größe
£163.00
- SKU:
- RP01821
- Zusätzliche Namen:
- FSH Beta|FSHB|HH24
- Molekulargewicht:
- 20-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asn19-Glu129
- Formulierung:
- Recombinant Human FSH Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Glu129) of human FSH Beta (Accession #NP_000501.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
- Uniprot:
- P01225
- Synonyme:
- follicle stimulating hormone beta subunit;follicle stimulating hormone, beta polypeptide;Follicle-stimulating hormone beta subunit;Follitropin beta chain;follitropin subunit beta;follitropin, beta chain;FSH-B;FSH-beta;HH24
- Weitere Details:
- Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
- Versandbedingungen:
- Blue Ice

