Recombinant Human Gastric inhibitory polypeptide/GIP Protein

Größe

£145.00

SKU:: RP01818
Zusätzliche Namen:: Gastric inhibitory polypeptide|GIP|Incretin
Molekulargewicht:: 35-45 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Tyr52-Gln93
Formulierung:: Recombinant Human GIP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr52-Gln93) of human GIP (Accession #NP_004114.1) fused with a hFc tag at the N-terminus.
Spezies:: Human
Sequenz:: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Uniprot:: P09681
Synonyme:: gastric inhibitory polypeptide;glucose-dependent insulinotropic polypeptide;incretin hormone
Weitere Details:: The potential application of glucose-dependent insulinotropic polypeptide (gastric inhibitory polypeptide, GIP) in the management of obesity and type 2 diabetes has been controversial. Initial interest in the therapeutic use of GIP was dampened by evidence that its insulinotropic activity was reduced in type 2 diabetes and by reports that it increased glucagon secretion and adipose deposition in non-diabetic individuals.