RP01806
Recombinant Mouse IL-23A/IL-23 p19 Protein
Größe
£145.00
- SKU:
- RP01806
- Zusätzliche Namen:
- IL-23|Il23a|p19
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala21-Ala196
- Formulierung:
- Recombinant Mouse IL-23A/IL-23 p19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Ala196) of mouse IL-23A (Accession #NP_112542.1) fused with 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- AVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
- Uniprot:
- Q9EQ14
- Synonyme:
- IL-;IL-23;IL-23 subunit alpha;IL-23-A;IL-23p19;interleukin-23 subunit alpha;interleukin-23 subunit p19;p1;p19
- Weitere Details:
- The heterodimeric cytokine interleukin-23 (IL-23 or IL23A/IL12B) is produced by dendritic cells and macrophages and promotes the proinflammatory and regenerative activities of T helper 17 (Th17) and innate lymphoid cells. A recent study has reported that IL-23 is also secreted by lung adenoma cells and generates an inflammatory and immune-suppressed stroma.
- Versandbedingungen:
- Blue Ice