RP01805
Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
Größe
£133.00
- SKU:
- RP01805
- Zusätzliche Namen:
- CD153|CD30L|CD30LG|TNFSF8|TNLG3A
- Molekulargewicht:
- 30-45 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln63-Asp234
- Formulierung:
- Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln63-Asp234) of human TNFSF8/CD30L (Accession #NP_001235.1) fused with 6xHis tag at the N-t
- Spezies:
- Human
- Sequenz:
- QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
- Uniprot:
- P32971
- Synonyme:
- CD153;CD153 antigen;CD30 antigen ligand;CD30 ligand;CD30-L;CD30L;CD30LG;TNLG3A;tumor necrosis factor (ligand) superfamily, member 8;tumor necrosis factor ligand 3A;tumor necrosis factor ligand superfamily member 8;tumor necrosis factor superfamily member 8
- Weitere Details:
- CD30 ligand (CD30L), also known as CD153 and TNFSF8, is a membrane-associated glycoprotein belonging to the TNF superfamily and TNFR superfamily, and is a specific ligand for CD30/TNFRSF8 originally described as a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. CD30L is a type-II membrane glycoprotein expressed on activated T cells, stimulated monocyte-macrophages, granulocytes, eosinophils, and some Burkitt-like lymphoma cell lines. CD30L is capable of transducing signals through CD30 on different CD30+ lymphoma cell lines, and mediates pleiotropic biologic effects including cell proliferation, activation, differentiation, as well as cell death by apoptosis. CD30-CD30 ligand interaction has been suggested to have a pathophysiologic role in malignant lymphomas, particularly Hodgkin disease, large cell anaplastic lymphomas and Burkitt lymphomas, and is also involved in activation and functioning of the T cell-dependent immune response. Thus, CD153 and its receptor CD30 are regarded as therapeutic targets in hematologic malignancies, autoimmune and inflammatory diseases.
- Versandbedingungen:
- Blue Ice