Recombinant Human Microtubule-associated protein tau/MAPT Protein

Größe

£145.00

SKU:: RP01804
Zusätzliche Namen:: DDPAC|FTDP-17|MAPTL|MSTD|MTBT1|MTBT2|PPND|PPP1R103|TAU|tau-40|Tau-PHF6
Molekulargewicht:: 45-75 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln88-Arg230
Formulierung:: Recombinant Human Microtubule-associated protein tau/MAPT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln88-Arg230) of human Microtubule-associated protein tau/MAPT (Accession #) fused with hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: QAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR
Uniprot:: P10636-8
Synonyme:: DDPAC;FTDP-17;G protein beta1/gamma2 subunit-interacting factor 1;MAPTL;microtubule-associated protein tau;MSTD;MTBT1;MTBT2;neurofibrillary tangle protein;paired helical filament-tau;PHF-tau;PPND;PPP1R103;protein phosphatase 1, regulatory subunit 103;TAU;tau-40
Weitere Details:: Tau proteins are proteins that stabilize microtubules. They are abundant in neurons of the central nervous system and are less common elsewhere, but are also expressed at very low levels in CNS astrocytes and oligodendrocytes. When tau proteins are defective, and no longer stabilize microtubules properly, they can result in dementias such as Alzheimer's disease. Tau protein is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are mostly found in neurons compared to non-neuronal cells. One of tau's main functions is to modulate the stability of axonal microtubules. Other nervous system MAPs may perform similar functions, as suggested by tau knockout mice, who did not show abnormalities in brain development - possibly because of compensation in tau deficiency by other MAPs.

Versandbedingungen:: Blue Ice