Recombinant Human MYDGF Protein

Größe

£133.00

SKU:: RP01790
Zusätzliche Namen:: MYDGF, C19orf10,Myeloid-derived growth factor, MYDGF
Molekulargewicht:: 18-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Val32-Leu173
Formulierung:: Recombinant Human MYDGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Leu173) of human MYDGF (Accession #NP_061980.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Uniprot:: Q969H8
Synonyme:: C19orf10;EUROIMAGE1875335;IL25;IL27;IL27w;interleukin 27 working designation;interleukin-25;myeloid-derived growth factor;R33729_1;SF20;stromal cell-derived growth factor SF20;UPF0556 protein C19orf10
Weitere Details:: Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation . MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages . Up-regulation of MYDGF expression was also found during adipocyte differentiation . Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway . MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP) .

Versandbedingungen:: Blue Ice