RP01789
Recombinant Rat IL-3 Protein
Größe
£145.00
- SKU:
- RP01789
- Zusätzliche Namen:
- IL-3|IL3
- Molekulargewicht:
- 25-30 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ile27-Cys169
- Formulierung:
- Recombinant Rat IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Cys169) of rat IL-3 (Accession #NP_113701.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Rat
- Sequenz:
- ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
- Uniprot:
- P97688
- Synonyme:
- hematopoietic growth factor;IL-3;interleukin-3;mast cell growth factor;MCGF;multipotential colony-stimulating factor;P-cell-stimulating factor
- Weitere Details:
- IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Versandbedingungen:
- Blue Ice