Recombinant Human TNFSF13/APRIL/CD256 Protein

Größe

£145.00

SKU:: RP01777
Zusätzliche Namen:: APRIL|CD256|TALL-2|TALL2|TNFSF13|TNLG7B|TRDL-1|UNQ383/PRO715|ZTNF2
Molekulargewicht:: 50 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Lys111-leu250
Formulierung:: Recombinant Human TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys111-leu250) of human TNFSF13 (Accession #NP_001185552.1) fused with and a hFc tag at the N-terminus.
Spezies:: Human
Sequenz:: KQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Uniprot:: O75888
Synonyme:: a proliferation-inducing ligand;APRIL;CD256;TALL-2;TALL2;TNF- and APOL-related leukocyte expressed ligand 2;TNF-related death ligand 1;TNLG7B;TRDL-1;tumor necrosis factor (ligand) superfamily, member 13;tumor necrosis factor ligand 7B;tumor necrosis factor ligand superfamily member 13;tumor necrosis factor superfamily member 13;tumor necrosis factor-like protein ZTNF2;tumor necrosis factor-related death ligand-1;UNQ383/PRO715;ZTNF2
Weitere Details:: TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.

Versandbedingungen:: Blue Ice