RP01772
Recombinant Human PDGF-AA Protein
Größe
£145.00
- SKU:
- RP01772
- Zusätzliche Namen:
- PDGF-A|PDGF1
- Molekulargewicht:
- 20 kDa kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser87-Thr211
- Formulierung:
- Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no additional amino acid.
- Spezies:
- Human
- Sequenz:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
- Uniprot:
- P04085
- Synonyme:
- PDGF A-chain;PDGF subunit A;PDGF-1;PDGF-A;PDGF1;Platelet-derived growth factor A chain;platelet-derived growth factor A-chain;platelet-derived growth factor alpha chain;platelet-derived growth factor alpha polypeptide;platelet-derived growth factor subunit A
- Weitere Details:
- Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
- Versandbedingungen:
- Blue Ice