RP01766
Recombinant Mouse IL-7 Protein

Größe
£193.00
- SKU:
- RP01766
- Zusätzliche Namen:
- A630026I06Rik; il7|hlb368|Il-7
- Molekulargewicht:
- 20-30 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu26-Ile154
- Formulierung:
- Recombinant Mouse IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #NP_032397.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
- Uniprot:
- P10168
- Synonyme:
- A630026I06Rik;hlb36;hlb368;Il;Il-7;interleukin-7
- Weitere Details:
- IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.
- Versandbedingungen:
- Blue Ice



