RP01752
Recombinant Human Interferon omega-1/IFNW1 Protein
Größe
£127.00
- SKU:
- RP01752
- Zusätzliche Namen:
- Interferon omega-1; IFNW1
- Molekulargewicht:
- 25-30 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly23-Ser195
- Formulierung:
- Recombinant Human Interferon omega-1/IFNW1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser195) of human Interferon omega-1/IFNW1 (Accession #NP_002168.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- GCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
- Uniprot:
- P05000
- Synonyme:
- IFN-omega 1, interferon omega-1;interferon alpha-II-1;interferon omega-1
- Weitere Details:
- IFNs are a large family of proteins having antiviral, antiproliferative, and immunomodulatory effects, and are divided into two major classes, type I and type II, based on differences in receptor binding and nucleotide sequence. Type I IFNs consist of IFN A Alpha, B Beta, T Tau, and W Omega and bind to the type I IFN receptor, whereas IFN-G Gamma is the only type II IFN and is specific for the type II IFN receptor. Human IFN-W Omega, was identified by three independent groups in 1985 and is structurally related to IFN-A Alpha and -B Beta. Both human IFN-W Omega and IFN-A Alpha are produced by virally induced leukocytes and have similar antiviral activities on human cell lines, and a sizeable proportion (at least 1%) of the total antiviral activity of leukocyte IFN is contributed by IFN-W Omegal. Also, it was reported that IFN-W Omega could inhibit the growth of human tumors in vivo.
- Versandbedingungen:
- Blue Ice