Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Größe

£145.00

SKU:: RP01744
Zusätzliche Namen:: Agpt2|Ang-2|Ang2
Molekulargewicht:: 35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Lys275-Phe496
Formulierung:: Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys275-Phe496) of mouse Angiopoietin-2/ANG-2/ANGPT2 (Accession #NP_031452.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Uniprot:: O35608
Synonyme:: Agpt2;An;Ang;Ang-2;Ang2;angiopoietin-2
Weitere Details:: Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization