Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein

Größe

£123.25

War £145.00

SKU:: RP01743
Zusätzliche Namen:: 1110046O21Rik|Ang-1|Ang1
Molekulargewicht:: 25-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Arg277-Phe498
Formulierung:: Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of mouse Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_033770.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Uniprot:: O08538
Synonyme:: 1110046O21Rik;an;Ang;Ang-1;Ang1;angiopoietin-1
Weitere Details:: The angiopoietin (ANGPT)-TIE2/TEK signaling pathway is essential for blood and lymphatic vascular homeostasis. ANGPT1 is a potent TIE2 activator, whereas ANGPT2 functions as a context-dependent agonist/antagonist. In disease, ANGPT2-mediated inhibition of TIE2 in blood vessels is linked to vascular leak, inflammation, and metastasis.