Recombinant Rat IFN-gamma Protein

Größe

£145.00

SKU:: RP01739
Zusätzliche Namen:: If2f|IFNG2; IFNG; IFN-gamma
Molekulargewicht:: 15-25 kDa
Reinheit:: 85%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln23-Cys156
Formulierung:: Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat IFN-gamma (Accession #NP_620235.1) fused with and a 6xHis tag at the C-terminus.
Spezies:: Rat
Sequenz:: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Uniprot:: P01581
Synonyme:: If2f;IFN-gamma;IFNG2;interferon 2f;interferon gamma
Weitere Details:: Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.